Recombinant Human NID1 protein, GST-tagged

• Cat.No.: NID1-186H
• Product Overview: Recombinant Human NID1(1148 a.a. - 1247 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1148-1247 a.a.
• Description: This gene encodes a member of the nidogen family of basement membrane glycoproteins. The protein interacts with several other components of basement membranes, and may play a role in cell interactions with the extracellular matrix.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHL CLATPGSRTCRCPDNTLGVDCIERK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: NID1 nidogen 1 [ Homo sapiens ]
• Official Symbol: NID1
• Synonyms: NID1; nidogen 1; NID, nidogen (enactin); nidogen-1; entactin; NID-1; enactin; NID
• Gene ID: 4811
• mRNA Refseq: NM_002508
• Protein Refseq: NP_002499
• MIM: 131390
• UniProt ID: P14543
• Chromosome Location: 1q43
• Function: calcium ion binding; collagen binding; extracellular matrix binding; laminin-1 binding