Recombinant Human NHP2L1, His-tagged

• Cat.No.: NHP2L1-28304TH
• Product Overview: Recombinant full length Human NHP2L1 with an N terminal His tag; 152 amino acids with tag, MWt 16.7 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 128 amino acids
• Description: Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the
• Conjugation: HIS
• Molecular Weight: 16.700kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Gene Information

• Gene Name: NHP2L1 NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: NHP2L1
• Synonyms: NHP2L1; NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae); non histone chromosome protein 2 (S. cerevisiae) like 1 , sperm specific antigen 1 , SSFA1; NHP2-like protein 1; 15.5K; FA 1; small nuclear ribonucleoprotein 15.5kDa (U4/U6.U5); SNRNP1
• Gene ID: 4809
• mRNA Refseq: NM_001003796
• Protein Refseq: NP_001003796
• MIM: 601304
• Uniprot ID: P55769
• Chromosome Location: 22q13
• Pathway: Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem
• Function: RNA binding; protein binding; contributes_to snoRNA binding