Recombinant Human NHLRC1 Protein, GST-tagged

• Cat.No.: NHLRC1-30H
• Product Overview: Human NHLRC1 partial ORF ( NP_940988.2, 137 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: The protein encoded by this gene is a single subunit E3 ubiquitin ligase. Laforin is polyubiquitinated by the encoded protein. Defects in this intronless gene lead to an accumulation of laforin and onset of Lafora disease, also known as progressive myoclonic epilepsy type 2 (EPM2).
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: KTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVDF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NHLRC1 NHL repeat containing E3 ubiquitin protein ligase 1 [ Homo sapiens (human) ]
• Official Symbol: NHLRC1
• Synonyms: NHLRC1; NHL repeat containing E3 ubiquitin protein ligase 1; EPM2A; EPM2B; MALIN; bA204B7.2; E3 ubiquitin-protein ligase NHLRC1; NHL repeat containing 1; NHL repeat-containing protein 1; RING-type E3 ubiquitin transferase NHLRC1; EC 2.3.2.27
• Gene ID: 378884
• mRNA Refseq: NM_198586
• Protein Refseq: NP_940988
• MIM: 608072
• UniProt ID: Q6VVB1