Recombinant Human NGFR, Fc-tagged
Cat.No. : | NGFR-30619TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-250 of Human p75 NGF Receptor fused to the Fc region of Human IgG1 expressed in modified Human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Protein Length : | 1-250 a.a. |
Description : | Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain. |
Conjugation : | Fc |
Biological activity : | The ED50 of this chimera is typically 0.7 - 1.0 ug/ml as measured by its ability to neutralize beta NGF mediated proliferation of the human growth factor dependent TF-1 cell line. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical sequence:KEACPTGLYTHSGECCKACNLGEGVAQPC GANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSM SAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLV FSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDT ERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAPS TQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNG SSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK |
Sequence Similarities : | Contains 1 death domain.Contains 4 TNFR-Cys repeats. |
Gene Name | NGFR nerve growth factor receptor [ Homo sapiens ] |
Official Symbol | NGFR |
Synonyms | NGFR; nerve growth factor receptor; nerve growth factor receptor (TNFR superfamily, member 16); tumor necrosis factor receptor superfamily member 16; CD271; low affinity nerve growth factor receptor; p75NTR; TNFR superfamily; member 16; TNFRSF16; |
Gene ID | 4804 |
mRNA Refseq | NM_002507 |
Protein Refseq | NP_002498 |
MIM | 162010 |
Uniprot ID | P08138 |
Chromosome Location | 17q21-q22 |
Pathway | Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Ceramide signalling, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; |
Function | death receptor activity; nerve growth factor binding; protein binding; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
NGFR-4704H | Recombinant Human NGFR Protein (Met1-Asn250), C-His tagged | +Inquiry |
NGFR-292H | Recombinant Human NGFR | +Inquiry |
NGFR-653H | Active Recombinant Human NGFR, Fc-tagged, Biotinylated | +Inquiry |
NGFR-6993H | Recombinant Human NGFR protein(Met1-Asn250), His-tagged | +Inquiry |
NGFR-1657R | Recombinant Rhesus Monkey NGFR Protein, hIgG4-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGFR-1670HCL | Recombinant Human NGFR cell lysate | +Inquiry |
NGFR-1679MCL | Recombinant Mouse NGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGFR Products
Required fields are marked with *
My Review for All NGFR Products
Required fields are marked with *
0
Inquiry Basket