Recombinant Human NFKB1 protein, T7/His-tagged

Cat.No. : NFKB1-120H
Product Overview : Recombinant human NFkB p50 subunit cDNA (2 - 433aa, derived from BC051765) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-433 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQI LEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDG ICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELI RQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLL CDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKP FLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHP GTTKSNAGMKHG
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human NFkB functional regulations study using NFkB p50 subunit protein mediated intracellular delivery.2. May be used as specific substrate protein for kinase and ubiquitin related enzyme functional screening assays.3. May be used as antigen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens ]
Official Symbol NFKB1
Synonyms NFKB1; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Gene ID 4790
mRNA Refseq NM_001165412
Protein Refseq NP_001158884
MIM 164011
UniProt ID P19838
Chromosome Location 4q24
Pathway Activated TLR4 signalling, organism-specific biosystem; Activation of NF-kappaB in B Cells, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem;
Function nucleic acid binding transcription factor activity; protein binding; regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; transcription regulatory region sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NFKB1 Products

Required fields are marked with *

My Review for All NFKB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon