Recombinant Human NFKB1 protein, His-tagged

• Cat.No.: NFKB1-3973H
• Product Overview: Recombinant Human NFKB1 protein(1-368 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-368 aa
• AA Sequence: MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLM
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens ]
• Official Symbol: NFKB1
• Synonyms: NFKB1; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; nuclear factor NF-kappa-B p105 subunit; KBF1; NF kappaB; NF kB1; NFkappaB; NFKB p50; p50; p105; NF-kappabeta; DNA binding factor KBF1; DNA-binding factor KBF1; nuclear factor NF-kappa-B p50 subunit; nuclear factor kappa-B DNA binding subunit; EBP-1; NF-kB1; NFKB-p50; NF-kappaB; NFKB-p105; NF-kappa-B; MGC54151; DKFZp686C01211
• Gene ID: 4790
• mRNA Refseq: NM_001165412
• Protein Refseq: NP_001158884
• MIM: 164011
• UniProt ID: P19838