Recombinant Full Length Human NFKB1 Protein
Cat.No. : | NFKB1-343HF |
Product Overview : | Recombinant full length protein of Human NFkB p105 / p50 with proprietary tag; predicted MW 132.66 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Two transcript variants encoding different isoforms have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 132.660kDa inclusive of tags |
Protein length : | 968 amino acids |
AA Sequence : | MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTA DGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKK SYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCE DGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTE ACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQA ALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAI YDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDD IQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYK DINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEV QRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGS TGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTES KKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNG EVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDY AVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLV RDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVE DLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKK AALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNA QEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDG TTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDS WENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTS DDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKL GLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQM GYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQIDELR DSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYG QEGPLEGKI |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens ] |
Official Symbol : | NFKB1 |
Synonyms : | NFKB1; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; nuclear factor NF-kappa-B p105 subunit; KBF1; NF kappaB; NFkappaB; NFKB p50; p50; p105 |
Gene ID : | 4790 |
mRNA Refseq : | NM_001165412 |
Protein Refseq : | NP_001158884 |
MIM : | 164011 |
UniProt ID : | P19838 |
Products Types
◆ Recombinant Protein | ||
NFKB1-563H | Recombinant Human NFKB1 protein, His-tagged | +Inquiry |
Nfkb1-4396M | Recombinant Mouse Nfkb1 Protein, Myc/DDK-tagged | +Inquiry |
NFKB1-786H | Recombinant Human NFKB1 protein, His-tagged | +Inquiry |
NFKB1-2487C | Recombinant Cattle NFKB1 Protein, His-tagged | +Inquiry |
NFKB1-2834R | Recombinant Rhesus Macaque NFKB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
NFKB1-3850HCL | Recombinant Human NFKB1 293 Cell Lysate | +Inquiry |
Related Gene
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Customer Reviews (3)
Write a reviewPotent biological activity of NFKB1, combined with its high purity, provides accurate and reliable experimental data for the research field.
The short half-life and high clearance of NFKB1 allow its rapid action and rapid clearance in vivo, improving therapeutic efficiency.
Beacuse production process of NFKB1 realizes the minimization of waste and the minimal impact on the environment, which is truly green production.
Q&As (6)
Ask a questionNFKB1 protein is involved in the occurrence and progression of autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus.
NFKB1 protein plays a complex role in apoptosis and may promote or inhibit the occurrence of apoptosis.
A variety of drugs have been developed that target the NFKB1 protein and its downstream signaling pathways, such as inhibiting NFKB1 activation or inhibiting the transcriptional activity of NFKB1 downstream genes.
The protein plays a key role in immune regulation and inflammatory response, and studying the function and regulatory mechanism of NFKB1 protein will help the development of new drugs, such as targeted drugs targeting NFKB1 protein and its signaling pathway may be applied to the treatment of related diseases.
This protein plays an important role in the activation of immune cells and the regulation of inflammation, so it can be used in immune vaccine design to enhance immune effects.
The expression pattern of NFKB1 protein in immune cells is regulated by different stimuli and environments, and participates in the activation and regulation of immune cells.
Ask a Question for All NFKB1 Products
Required fields are marked with *
My Review for All NFKB1 Products
Required fields are marked with *
Inquiry Basket