Recombinant Human NFIX

• Cat.No.: NFIX-30379TH
• Product Overview: Recombinant fragment of Human NFIX with an N terminal proprietary tag; Predicted MW 36.63kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Nuclear factor 1 X-type is a protein that in humans is encoded by the NFIX gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR
• Sequence Similarities: Belongs to the CTF/NF-I family.Contains 1 CTF/NF-I DNA-binding domain.

Gene Information

• Gene Name: NFIX nuclear factor I/X (CCAAT-binding transcription factor) [ Homo sapiens ]
• Official Symbol: NFIX
• Synonyms: NFIX; nuclear factor I/X (CCAAT-binding transcription factor); nuclear factor 1 X-type; NF1A
• Gene ID: 4784
• mRNA Refseq: NM_002501
• Protein Refseq: NP_002492
• MIM: 164005
• Uniprot ID: Q14938
• Chromosome Location: 19p13.3
• Pathway: Oxidative Stress, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; RNA Polymerase III Abortive And Retractive Initiation, organism-specific biosystem; RNA Polymerase III Transcription, organism-specific biosystem; RNA Polymerase III Transcription Termination, organism-specific biosystem
• Function: DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity