Recombinant Human NFIL3 protein, T7/His-tagged
Cat.No. : | NFIL3-150H |
Product Overview : | Recombinant human NFIL3 cDNA (461 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEEL LLSEGSVGKNKSSACRRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELL SLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIKHSPQSSLSDVSEVSS VEHTQESSVQGSCRSPENKFQIIKQEPMELESYTREPRDDRGSYTASIYQNYMGNSFSGYSHSPPLLQVNRSSSN SPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEF EATQKLSSPIDMTSKRHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | NFIL3 nuclear factor, interleukin 3 regulated [ Homo sapiens ] |
Official Symbol | NFIL3 |
Synonyms | NFIL3; nuclear factor, interleukin 3 regulated; IL3BP1; nuclear factor interleukin-3-regulated protein; E4BP4; NF IL3A; NFIL3A; E4 promoter-binding protein 4; interleukin-3-binding protein 1; transcriptional activator NF-IL3A; nuclear factor interleukin 3 regulated protein; interleukin-3 promoter transcriptional activator; NF-IL3A; |
Gene ID | 4783 |
mRNA Refseq | NM_005384 |
Protein Refseq | NP_005375 |
MIM | 605327 |
UniProt ID | Q16649 |
Chromosome Location | 9q22 |
Function | DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II regulatory region sequence-specific DNA binding; protein dimerizat |
◆ Recombinant Proteins | ||
NFIL3-1229Z | Recombinant Zebrafish NFIL3 | +Inquiry |
NFIL3-6037M | Recombinant Mouse NFIL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NFIL3-2833R | Recombinant Rhesus Macaque NFIL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NFIL3-3014R | Recombinant Rhesus monkey NFIL3 Protein, His-tagged | +Inquiry |
NFIL3-6186C | Recombinant Chicken NFIL3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFIL3-1189HCL | Recombinant Human NFIL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFIL3 Products
Required fields are marked with *
My Review for All NFIL3 Products
Required fields are marked with *
0
Inquiry Basket