Recombinant Human NFATC3 Protein, His-tagged

• Cat.No.: NFATC3-01H
• Product Overview: Recombinant Human NFATC3 Protein, His-tagged,expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: 900-1035 aa
• Molecular Mass: 15 kDa
• AA Sequence: MDQITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1mg/ml by BCA
• Storage Buffer: Sterile PBS, pH 7.4

Gene Information

• Gene Name: NFATC3 nuclear factor of activated T cells 3 [ Homo sapiens (human) ]
• Official Symbol: NFATC3
• Synonyms: NFAT4,NFATX, NF-AT4c,n339260,NFATC3
• Gene ID: 4775
• MIM: 602698
• UniProt ID: Q12968