Recombinant Human NFATC3

• Cat.No.: NFATC3-29252TH
• Product Overview: Recombinant fragment corresponding to amino acids 70-149 of Human NFAT4 with an N terminal proprietary tag; Predicted MWt 34.43 kDa.

Specification

• Description: The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene.
• Protein length: 80 amino acids
• Molecular Weight: 34.430kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Isoform 1 is predominantly expressed in thymus and is also found in peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, hear
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
• Sequence Similarities: Contains 1 RHD (Rel-like) domain.
• Tag: Non

Gene Information

• Gene Name: NFATC3 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 [ Homo sapiens ]
• Official Symbol: NFATC3
• Synonyms: NFATC3; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3; nuclear factor of activated T-cells, cytoplasmic 3; NFAT4; NFATX
• Gene ID: 4775
• mRNA Refseq: NM_004555
• Protein Refseq: NP_004546
• MIM: 602698
• Uniprot ID: Q12968
• Chromosome Location: 16q22
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem
• Function: DNA binding; chromatin binding; sequence-specific DNA binding transcription factor activity