Recombinant Human NFATC3

Cat.No. : NFATC3-29252TH
Product Overview : Recombinant fragment corresponding to amino acids 70-149 of Human NFAT4 with an N terminal proprietary tag; Predicted MWt 34.43 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene.
Protein length : 80 amino acids
Molecular Weight : 34.430kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Isoform 1 is predominantly expressed in thymus and is also found in peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, hear
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
Sequence Similarities : Contains 1 RHD (Rel-like) domain.
Tag : Non
Gene Name NFATC3 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 [ Homo sapiens ]
Official Symbol NFATC3
Synonyms NFATC3; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3; nuclear factor of activated T-cells, cytoplasmic 3; NFAT4; NFATX;
Gene ID 4775
mRNA Refseq NM_004555
Protein Refseq NP_004546
MIM 602698
Uniprot ID Q12968
Chromosome Location 16q22
Pathway Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem;
Function DNA binding; chromatin binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NFATC3 Products

Required fields are marked with *

My Review for All NFATC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon