Recombinant Human NF1, GST-tagged

• Cat.No.: NF1-335H
• Product Overview: Recombinant Human NF1(2719 a.a. - 2818 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene product appears to function as a negative regulator of the ras signal transduction pathway. Mutations in this gene have been linked to neurofibromatosis type 1, juvenile myelomonocytic leukemia and Watson syndrome. The mRNA for this gene is subject to RNA editing (CGA>UGA->Arg1306Term) resulting in premature translation termination. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene.
• Molecular Mass: 36.74 kDa
• AA Sequence: DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTR HGSASQVQKQRSAGSFKRNSIKKIV
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NF1 neurofibromin 1 [ Homo sapiens (human) ]
• Official Symbol: NF1
• Synonyms: NF1; WSS; NFNS; VRNF; neurofibromin 1; neurofibromin; neurofibromatosis-related protein NF-1
• Gene ID: 4763
• mRNA Refseq: NM_000267
• Protein Refseq: NP_000258
• MIM: 613113
• UniProt ID: P21359
• Chromosome Location: 17q11.2
• Pathway: ATF-2 transcription factor network; FOXA2 and FOXA3 transcription factor networks; Integrated Breast Cancer Pathway
• Function: Ras GTPase activator activity; phosphatidylcholine binding; phosphatidylethanolamine binding