Recombinant Human NEU1, His-tagged

• Cat.No.: NEU1-156H
• Product Overview: Recombinant Human Sialidase-1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu48-Leu415) of Human NEU1 fused with a 6His tag at the C-terminus.

Specification

• Description: Sialidase-1 belongs to the N-acetyl-a neuraminidase family. Sialidase-1 is expressed in many tissues; it is highly expressed in the pancreas, and weakly expressed in the brain. Sialidase-1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. Deficiencies in the human enzyme Sialidase-1 leads to sialidosis, a rare lysosomal storage disease. Sialidase-1 has been shown to interact with Cathepsin A (protective protein), β-galactosidase and N-acetylgalactosamine-6-sulfate sulfatase in a multienzyme complex.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALR RSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDD GVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRY GSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDV TFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSS LATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTLVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: NEU1 sialidase 1 (lysosomal sialidase) [ Homo sapiens ]
• Official Symbol: NEU1
• Synonyms: NEU1; sialidase 1 (lysosomal sialidase); NEU; sialidase-1; G9 sialidase; exo-alpha-sialidase; lysosomal sialidase; acetylneuraminyl hydrolase; N-acetyl-alpha-neuraminidase 1; NANH; SIAL1; FLJ93471
• Gene ID: 4758
• mRNA Refseq: NM_000434
• Protein Refseq: NP_000425
• MIM: 608272
• UniProt ID: Q99519
• Chromosome Location: 6p21
• Pathway: Glycosphingolipid metabolism, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem
• Function: exo-alpha-(2->3)-sialidase activity; exo-alpha-(2->6)-sialidase activity; exo-alpha-(2->8)-sialidase activity; exo-alpha-sialidase activity; hydrolase activity, acting on glycosyl bonds