Recombinant Human NEDD9 Protein, His tagged

Cat.No. : NEDD9-001H
Product Overview : Recombinant Human NEDD9 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 153-366 aa
Description : The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants.
Tag : C-His
Molecular Mass : 25 kDa
AA Sequence : MKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol
Concentration : 1 mg/mL by BCA
Gene Name NEDD9 neural precursor cell expressed, developmentally down-regulated 9 [ Homo sapiens (human) ]
Official Symbol NEDD9
Synonyms NEDD9; neural precursor cell expressed, developmentally down-regulated 9; enhancer of filamentation 1; Cas scaffolding protein family member 2; CAS L; Cas like; CASS2; HEF1; p105; NEDD-9; cas-like docking; Crk-associated substrate related; renal carcinoma antigen NY-REN-12; CRK-associated substrate-related protein; dJ761I2.1 (enhancer of filamentation (HEF1)); dJ49G10.2 (Enhancer of Filamentation 1 (HEF1)); neural precursor cell expressed developmentally down-regulated protein 9; CAS2; CASL; CAS-L; dJ49G10.2; dJ761I2.1
Gene ID 4739
mRNA Refseq NM_001142393
Protein Refseq NP_001135865
MIM 602265
UniProt ID Q14511

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NEDD9 Products

Required fields are marked with *

My Review for All NEDD9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon