Recombinant Human NEDD9 Protein, His tagged
Cat.No. : | NEDD9-001H |
Product Overview : | Recombinant Human NEDD9 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 153-366 aa |
Description : | The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants. |
Tag : | C-His |
Molecular Mass : | 25 kDa |
AA Sequence : | MKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
Concentration : | 1 mg/mL by BCA |
Gene Name | NEDD9 neural precursor cell expressed, developmentally down-regulated 9 [ Homo sapiens (human) ] |
Official Symbol | NEDD9 |
Synonyms | NEDD9; neural precursor cell expressed, developmentally down-regulated 9; enhancer of filamentation 1; Cas scaffolding protein family member 2; CAS L; Cas like; CASS2; HEF1; p105; NEDD-9; cas-like docking; Crk-associated substrate related; renal carcinoma antigen NY-REN-12; CRK-associated substrate-related protein; dJ761I2.1 (enhancer of filamentation (HEF1)); dJ49G10.2 (Enhancer of Filamentation 1 (HEF1)); neural precursor cell expressed developmentally down-regulated protein 9; CAS2; CASL; CAS-L; dJ49G10.2; dJ761I2.1 |
Gene ID | 4739 |
mRNA Refseq | NM_001142393 |
Protein Refseq | NP_001135865 |
MIM | 602265 |
UniProt ID | Q14511 |
◆ Recombinant Proteins | ||
NEDD9-3746HF | Recombinant Full Length Human NEDD9 Protein, GST-tagged | +Inquiry |
Nedd9-4361M | Recombinant Mouse Nedd9 Protein, Myc/DDK-tagged | +Inquiry |
NEDD9-76HFL | Recombinant Full Length Human NEDD9 Protein, C-Flag-tagged | +Inquiry |
NEDD9-3265H | Recombinant Human NEDD9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NEDD9-10562M | Recombinant Mouse NEDD9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEDD9-1182HCL | Recombinant Human NEDD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEDD9 Products
Required fields are marked with *
My Review for All NEDD9 Products
Required fields are marked with *
0
Inquiry Basket