Recombinant Human NDUFB10 protein, GST-tagged

• Cat.No.: NDUFB10-3269H
• Product Overview: Recombinant Human NDUFB10 protein(O96000)(1-172aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.8 kDa
• Protein length: 1-172aa
• AA Sequence: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: NDUFB10 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa [ Homo sapiens ]
• Official Symbol: NDUFB10
• Synonyms: NDUFB10; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (22kD, PDSW); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10; complex I PDSW subunit; PDSW; CI-PDSW; complex I-PDSW; NADH-ubiquinone oxidoreductase PDSW subunit; NADH ubiquinone oxidoreductase PDSW subunit (RH 16p13.3)
• Gene ID: 4716
• mRNA Refseq: NM_004548
• Protein Refseq: NP_004539
• MIM: 603843
• UniProt ID: O96000