Recombinant Human NDUFB10 protein, GST-tagged

Cat.No. : NDUFB10-3269H
Product Overview : Recombinant Human NDUFB10 protein(O96000)(1-172aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-172aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 47.8 kDa
AA Sequence : MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name NDUFB10 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa [ Homo sapiens ]
Official Symbol NDUFB10
Synonyms NDUFB10; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (22kD, PDSW); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10; complex I PDSW subunit; PDSW; CI-PDSW; complex I-PDSW; NADH-ubiquinone oxidoreductase PDSW subunit; NADH ubiquinone oxidoreductase PDSW subunit (RH 16p13.3);
Gene ID 4716
mRNA Refseq NM_004548
Protein Refseq NP_004539
MIM 603843
UniProt ID O96000

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NDUFB10 Products

Required fields are marked with *

My Review for All NDUFB10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon