Recombinant Human NDUFA6 Protein (27-154 aa), GST-tagged

• Cat.No.: NDUFA6-679H
• Product Overview: Recombinant Human NDUFA6 Protein (27-154 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transport. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 27-154 aa
• Description: Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 42.1 kDa
• AA Sequence: MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: NDUFA6 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6, 14kDa [ Homo sapiens ]
• Official Symbol: NDUFA6
• Synonyms: NDUFA6; B14; CI B14; LYRM6; NADHB14; Complex I-B14; CI-B14
• Gene ID: 4700
• mRNA Refseq: NM_002490
• Protein Refseq: NP_002481
• MIM: 602138
• UniProt ID: P56556