Recombinant Human NDUFA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NDUFA2-2194H
• Product Overview: NDUFA2 MS Standard C13 and N15-labeled recombinant protein (NP_002479) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex 1), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane, and may be involved in regulating complex I activity or its assembly via assistance in redox processes. Mutations in this gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder. Alternative splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 10.9 kDa
• AA Sequence: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NDUFA2 NADH:ubiquinone oxidoreductase subunit A2 [ Homo sapiens (human) ]
• Official Symbol: NDUFA2
• Synonyms: NDUFA2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (8kD, B8); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2; B8; complex I B8 subunit; NADH-ubiquinone oxidoreductase subunit CI-B8; CD14; CIB8
• Gene ID: 4695
• mRNA Refseq: NM_002488
• Protein Refseq: NP_002479
• MIM: 602137
• UniProt ID: O43678