Recombinant Human NDUFA12 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NDUFA12-699H
• Product Overview: NDUFA12 MS Standard C13 and N15-labeled recombinant protein (NP_061326) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 17.1 kDa
• AA Sequence: MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLAARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NDUFA12 NADH:ubiquinone oxidoreductase subunit A12 [ Homo sapiens (human) ]
• Official Symbol: NDUFA12
• Synonyms: NDUFA12; B17.2; DAP13; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12; CI-B17.2; complex I B17.2 subunit; 13 kDa differentiation-associated protein; NADH-ubiquinone oxidoreductase subunit B17.2; EC 1.6.5.3; EC 1.6.99.3
• Gene ID: 55967
• mRNA Refseq: NM_018838
• Protein Refseq: NP_061326
• MIM: 614530
• UniProt ID: Q9UI09