Recombinant Human NDNL2 protein, GST-tagged

• Cat.No.: NDNL2-301291H
• Product Overview: Recombinant Human NDNL2 (1-90 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ser90
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: NDNL2 necdin-like 2 [ Homo sapiens ]
• Official Symbol: NDNL2
• Synonyms: NDNL2; necdin-like 2; melanoma-associated antigen G1; HCA4; MAGEG1; MAGEL3; NSE3; NSMCE3; MAGE-G1 antigen; necdin-like gene 2; necdin-like protein 2; melanoma antigen, family G, 1; hepatocellular carcinoma-associated protein 4; hepatocellular carcinoma-associated protein HCA4
• Gene ID: 56160
• mRNA Refseq: NM_138704
• Protein Refseq: NP_619649
• MIM: 608243
• UniProt ID: Q96MG7