Recombinant Human NCR3 Protein, Fc-tagged

Cat.No. : NCR3-399H
Product Overview : Recombinant human NCR3 protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.
Source : HEK293
Species : Human
Tag : Fc
Form : Lyophilized
Molecular Mass : 39.5 kDa
Protein length : 201
AA Sequence : MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name NCR3 natural cytotoxicity triggering receptor 3 [ Homo sapiens (human) ]
Official Symbol NCR3
Synonyms NCR3; natural cytotoxicity triggering receptor 3; LY117, lymphocyte antigen 117; 1C7; CD337; NKp30; NK-p30; lymphocyte antigen 117; activating NK-A1 receptor; activating natural killer receptor p30; natural killer cell p30-related protein; MALS; LY117;
Gene ID 259197
mRNA Refseq NM_001145466
Protein Refseq NP_001138938
MIM 611550
UniProt ID O14931

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NCR3 Products

Required fields are marked with *

My Review for All NCR3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon