Recombinant Human NCF2 protein, GST-tagged

• Cat.No.: NCF2-4544H
• Product Overview: Recombinant Human NCF2 protein(1-345 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-345 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: NCF2
• Synonyms: NCF2; neutrophil cytosolic factor 2; neutrophil cytosolic factor 2 (65kD, chronic granulomatous disease, autosomal 2); neutrophil cytosol factor 2; chronic granulomatous disease; autosomal 2; NADPH oxidase activator 2; NOXA2; p67phox; 67 kDa neutrophil oxidase factor; neutrophil NADPH oxidase factor 2; chronic granulomatous disease, autosomal 2; NCF-2; P67PHOX; P67-PHOX; FLJ93058
• Gene ID: 4688
• mRNA Refseq: NM_000433
• Protein Refseq: NP_000424
• MIM: 608515
• UniProt ID: P19878