Recombinant Human NCEH1 Protein, GST-tagged

• Cat.No.: NCEH1-012H
• Product Overview: Human AADACL1 full-length ORF ( AAH47588, 1 a.a. - 408 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NCEH1 (Neutral Cholesterol Ester Hydrolase 1) is a Protein Coding gene. Among its related pathways are Metabolism and Lipoprotein metabolism. GO annotations related to this gene include hydrolase activity and phosphate ion binding. An important paralog of this gene is AADAC.
• Molecular Mass: 70.62 kDa
• AA Sequence: MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAKVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYIMTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NCEH1 neutral cholesterol ester hydrolase 1 [ Homo sapiens ]
• Official Symbol: NCEH1
• Synonyms: NCEH1; neutral cholesterol ester hydrolase 1; AADACL1, arylacetamide deacetylase like 1; KIAA1363; NCEH; arylacetamide deacetylase-like 1; AADACL1
• Gene ID: 57552
• mRNA Refseq: NM_001146276
• Protein Refseq: NP_001139748
• MIM: 613234
• UniProt ID: Q6PIU2