Recombinant Human NCAPH Protein, GST-tagged

• Cat.No.: NCAPH-346H
• Product Overview: Human BRRN1 partial ORF ( AAH24211, 645 a.a. - 741 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.30 kDa
• AA Sequence: KKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NCAPH non-SMC condensin I complex, subunit H [ Homo sapiens ]
• Official Symbol: NCAPH
• Synonyms: NCAPH; non-SMC condensin I complex, subunit H; barren (Drosophila) homolog , barren homolog (Drosophila) , barren homolog 1 (Drosophila) , BRRN1; condensin complex subunit 2; CAP H; hCAP H; XCAP-H homolog; barren homolog 1; barren homolog protein 1; chromosome-associated protein H; BRRN1; CAP-H; HCAP-H
• Gene ID: 23397
• mRNA Refseq: NM_015341
• Protein Refseq: NP_056156
• MIM: 602332
• UniProt ID: Q15003