Recombinant Human NCAPG2 Protein, GST-tagged

• Cat.No.: NCAPG2-4576H
• Product Overview: Human LUZP5 partial ORF ( NP_060230, 177 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPG2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM
• Molecular Mass: 36.52 kDa
• AA Sequence: TKTGADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGRRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NCAPG2 non-SMC condensin II complex, subunit G2 [ Homo sapiens ]
• Official Symbol: NCAPG2
• Synonyms: NCAPG2; non-SMC condensin II complex, subunit G2; leucine zipper protein 5 , LUZP5; condensin-2 complex subunit G2; CAP G2; FLJ20311; hCAP G2; MTB; more than blood homolog; leucine zipper protein 5; chromosome-associated protein G2; LUZP5; CAP-G2; hCAP-G2
• Gene ID: 54892
• mRNA Refseq: NM_017760
• Protein Refseq: NP_060230
• MIM: 608532
• UniProt ID: Q86XI2