Recombinant Human NCAPG Protein, GST-tagged

• Cat.No.: NCAPG-4613H
• Product Overview: Human HCAP-G partial ORF ( AAH00827, 336 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 336-435 a.a.
• Description: This gene encodes a subunit of the condensin complex, which is responsible for the condensation and stabilization of chromosomes during mitosis and meiosis. Phosphorylation of the encoded protein activates the condensin complex. There are pseudogenes for this gene on chromosomes 8 and 15. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
• Molecular Mass: 36.63 kDa
• AA Sequence: TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NCAPG non-SMC condensin I complex, subunit G [ Homo sapiens ]
• Official Symbol: NCAPG
• Synonyms: NCAPG; non-SMC condensin I complex, subunit G; condensin complex subunit 3; CAP G; chromosome condensation protein G; FLJ12450; hCAP G; XCAP-G homolog; condensin subunit CAP-G; melanoma antigen NY-MEL-3; chromosome-associated protein G; CAPG; CHCG; HCAP-G; NY-MEL-3; MGC126525
• Gene ID: 64151
• mRNA Refseq: NM_022346
• Protein Refseq: NP_071741
• MIM: 606280
• UniProt ID: Q9BPX3