Recombinant Human NCAM1

• Cat.No.: NCAM1-30370TH
• Product Overview: Recombinant fragment corresponding to amino acids 611-710 of Human NCAM with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein has been shown to be involved in development of the nervous system, and for cells involved in the expansion of T cells and dendritic cells which play an important role in immune surveillance. Alternative splicing results in multiple transcript variants.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
• Sequence Similarities: Contains 2 fibronectin type-III domains.Contains 5 Ig-like C2-type (immunoglobulin-like) domains.

Gene Information

• Gene Name: NCAM1 neural cell adhesion molecule 1 [ Homo sapiens ]
• Official Symbol: NCAM1
• Synonyms: NCAM1; neural cell adhesion molecule 1; CD56; NCAM
• Gene ID: 4684
• mRNA Refseq: NM_000615
• Protein Refseq: NP_000606
• MIM: 116930
• Uniprot ID: P13591
• Chromosome Location: 11q23-q24
• Pathway: Axon guidance, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Developmental Biology, organism-specific biosystem