Recombinant Human NAXE Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NAXE-4564H
• Product Overview: APOA1BP MS Standard C13 and N15-labeled recombinant protein (NP_658985) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes.
• Molecular Mass: 31.7 kDa
• AA Sequence: MSRLRALLGLGLLVAGSRLPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NAXE NAD(P)HX epimerase [ Homo sapiens (human) ]
• Official Symbol: NAXE
• Synonyms: NAXE; NAD(P)HX epimerase; AIBP; PEBEL; YJEFN1; APOA1BP; NAD(P)H-hydrate epimerase; AI-BP; apoA-I binding protein; apolipoprotein A-I-binding protein; yjeF N-terminal domain-containing protein 1; yjeF_N1; EC 5.1.99.6
• Gene ID: 128240
• mRNA Refseq: NM_144772
• Protein Refseq: NP_658985
• MIM: 608862
• UniProt ID: Q8NCW5