Recombinant Human NAPRT Protein (229-538 aa), His-tagged

• Cat.No.: NAPRT-1470H
• Product Overview: Recombinant Human NAPRT Protein (229-538 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 229-538 aa
• Description: Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.2 kDa
• AA Sequence: MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: NAPRT nicotinate phosphoribosyltransferase [ Homo sapiens (human) ]
• Official Symbol: NAPRT
• Synonyms: NAPRT1; PP3856
• Gene ID: 93100
• mRNA Refseq: NM_001286829
• Protein Refseq: NP_001273758
• UniProt ID: Q6XQN6