Recombinant Human NAPA protein, T7-tagged

Cat.No. : NAPA-127H
Product Overview : Recombinant human NAPA (295aa, Isoform-1) fused with T7 tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 295 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAA GNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELV DIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAAL CHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKT IQGDEEDLR
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro autophage / Bcl2 mediated apoptosis regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development and cancer diagnostic development.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha [ Homo sapiens ]
Official Symbol NAPA
Synonyms SNAPA
Gene ID 8775
mRNA Refseq NM_003827.3
Protein Refseq NP_003818.2
MIM 603215
UniProt ID P54920
Chromosome Location 19q13.33
Pathway Clathrin derived vesicle budding, organism-specific biosystem;Golgi Associated Vesicle Biogenesis, organism-specific biosystem;Membrane Trafficking, organism-specific biosystem;Synaptic vesicle cycle, organism-specific biosystem;Synaptic vesicle cycle, conserved biosystem;trans-Golgi Network Vesicle Budding, organism-specific biosystem;
Function protein binding;syntaxin binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NAPA Products

Required fields are marked with *

My Review for All NAPA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon