Recombinant Human NANS, His-tagged

• Cat.No.: NANS-28783TH
• Product Overview: Recombinant full length Human NANS with N terminal His tag; 379 amino acids with tag; MWt 42.4kDa.

Specification

• Description: This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant.
• Protein length: 359 amino acids
• Conjugation: HIS
• Molecular Weight: 42.400kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
• Sequence Similarities: Contains 1 AFP-like domain.

Gene Information

• Gene Name: NANS N-acetylneuraminic acid synthase [ Homo sapiens ]
• Official Symbol: NANS
• Synonyms: NANS; N-acetylneuraminic acid synthase; sialic acid synthase; SAS
• Gene ID: 54187
• mRNA Refseq: NM_018946
• Protein Refseq: NP_061819
• MIM: 605202
• Uniprot ID: Q9NR45
• Chromosome Location: 9p24.1-p23
• Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; CMP-N-acetylneuraminate biosynthesis I (eukaryotes), conserved biosystem; Metabolic pathways, organism-specific biosystem; superpathway of sialic acid and CMP-sialic acid biosynthesis, conserved biosystem
• Function: N-acetylneuraminate synthase activity; N-acylneuraminate cytidylyltransferase activity; N-acylneuraminate-9-phosphate synthase activity; transferase activity