Recombinant Human NANS, His-tagged
Cat.No. : | NANS-28783TH |
Product Overview : | Recombinant full length Human NANS with N terminal His tag; 379 amino acids with tag; MWt 42.4kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 359 amino acids |
Description : | This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. |
Conjugation : | HIS |
Molecular Weight : | 42.400kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS |
Sequence Similarities : | Contains 1 AFP-like domain. |
Gene Name | NANS N-acetylneuraminic acid synthase [ Homo sapiens ] |
Official Symbol | NANS |
Synonyms | NANS; N-acetylneuraminic acid synthase; sialic acid synthase; SAS; |
Gene ID | 54187 |
mRNA Refseq | NM_018946 |
Protein Refseq | NP_061819 |
MIM | 605202 |
Uniprot ID | Q9NR45 |
Chromosome Location | 9p24.1-p23 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; CMP-N-acetylneuraminate biosynthesis I (eukaryotes), conserved biosystem; Metabolic pathways, organism-specific biosystem; superpathway of sialic acid and CMP-sialic acid biosynthesis, conserved biosystem; |
Function | N-acetylneuraminate synthase activity; N-acylneuraminate cytidylyltransferase activity; N-acylneuraminate-9-phosphate synthase activity; transferase activity; |
◆ Recombinant Proteins | ||
NANS-2867H | Recombinant Human N-acetylneuraminic Acid Synthase, His-tagged | +Inquiry |
NANS-28783TH | Recombinant Human NANS, His-tagged | +Inquiry |
NANS-1477H | Recombinant Human NANS Protein, His (Fc)-Avi-tagged | +Inquiry |
NANS-4947H | Recombinant Human NANS Protein (Met1-Ser359), N-His tagged | +Inquiry |
NANS-1816C | Recombinant Chicken NANS | +Inquiry |
◆ Cell & Tissue Lysates | ||
NANS-3979HCL | Recombinant Human NANS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NANS Products
Required fields are marked with *
My Review for All NANS Products
Required fields are marked with *
0
Inquiry Basket