Recombinant Human NAGK protein, T7-tagged
Cat.No. : | NAGK-146H |
Product Overview : | Recombinant human NAGK (19 - 419aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 19-419 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMRTRTGSQLAAREVTGSGAVPRQLEGRRCQAGRDANGGTSSDGSSSMAAIYGGVEGGGTR SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIE ELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAV KIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAG EMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALG GASLGARHIGHLLPMDYSANAIAFYSYTFS |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro NAGK mediated protein glycosylation modification study with this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NAGK protein-protein interaction.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | NAGK N-acetylglucosamine kinase [ Homo sapiens ] |
Official Symbol | NAGK |
Synonyms | NAGK; N-acetylglucosamine kinase; N-acetyl-D-glucosamine kinase; GNK; glcNAc kinase; HSA242910; |
Gene ID | 55577 |
mRNA Refseq | NM_017567 |
Protein Refseq | NP_060037 |
MIM | 606828 |
UniProt ID | Q9UJ70 |
Chromosome Location | 2p24.3-p24.1 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; N-acetylglucosamine degradation II, organism-specific biosystem; |
Function | ATP binding; N-acetylglucosamine kinase activity; N-acylmannosamine kinase activity; kinase activity; nucleotide binding; protein binding; transferase activity; |
◆ Recombinant Proteins | ||
NAGK-183H | Recombinant Human NAGK Protein, MYC/DDK-tagged | +Inquiry |
NAGK-2946H | Recombinant Human N-acetylglucosamine Kinase, T7-tagged | +Inquiry |
NAGK-3551R | Recombinant Rat NAGK Protein, His (Fc)-Avi-tagged | +Inquiry |
NAGK-4973H | Recombinant Human NAGK Protein (Ala2-Ser344), C-His tagged | +Inquiry |
NAGK-146H | Recombinant Human NAGK protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAGK-428HCL | Recombinant Human NAGK lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAGK Products
Required fields are marked with *
My Review for All NAGK Products
Required fields are marked with *
0
Inquiry Basket