Recombinant Human NAGA Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NAGA-5419H
Product Overview : NAGA MS Standard C13 and N15-labeled recombinant protein (NP_000253) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : NAGA encodes the lysosomal enzyme alpha-N-acetylgalactosaminidase, which cleaves alpha-N-acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease).
Molecular Mass : 46.6 kDa
AA Sequence : MLLKTVLLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NAGA alpha-N-acetylgalactosaminidase [ Homo sapiens (human) ]
Official Symbol NAGA
Synonyms NAGA; N-acetylgalactosaminidase, alpha-; alpha-N-acetylgalactosaminidase; D22S674; alpha-galactosidase B; Acetylgalactosaminidase, alpha-N- (alpha-galactosidase B); GALB;
Gene ID 4668
mRNA Refseq NM_000262
Protein Refseq NP_000253
MIM 104170
UniProt ID P17050

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NAGA Products

Required fields are marked with *

My Review for All NAGA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon