Recombinant Human NACC1 protein, His-tagged

• Cat.No.: NACC1-1169H
• Product Overview: Recombinant Human NACC1 protein(173-527 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 173-527 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: NACC1 nucleus accumbens associated 1, BEN and BTB (POZ) domain containing [ Homo sapiens ]
• Official Symbol: NACC1
• Synonyms: NACC1; nucleus accumbens associated 1, BEN and BTB (POZ) domain containing; BTB (POZ) domain containing 14B , BTBD14B; nucleus accumbens-associated protein 1; BEN domain containing 8; BEND8; NAC 1; NAC1; nucleus accumbens associated 1; transcriptional repressor NAC1; BTB/POZ domain-containing protein 14B; NAC-1; BTBD14B; FLJ37383
• Gene ID: 112939
• mRNA Refseq: NM_052876.3
• Protein Refseq: NP_443108.1
• MIM: 610672
• UniProt ID: Q96RE7