Recombinant Human NAAA, His-tagged
Cat.No. : | NAAA-34H |
Product Overview : | Recombinant Human N-Acylethanolamine-Hydrolyzing Acid Amidase/NAAA is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser29-Glu199) of Human NAAA fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 29-199 a.a. |
AA Sequence : | SPPAAPRFNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQ PFTGEIRGMCDFMNLSLADCLLVNLAYESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVD VQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDPEVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | NAAA N-acylethanolamine acid amidase [ Homo sapiens ] |
Official Symbol | NAAA |
Synonyms | NAAA; N-acylethanolamine acid amidase; ASAHL, N acylsphingosine amidohydrolase (acid ceramidase) like; N-acylethanolamine-hydrolyzing acid amidase; ASAH-like protein; acid ceramidase-like protein; PLT; ASAHL; |
Gene ID | 27163 |
mRNA Refseq | NM_001042402 |
Protein Refseq | NP_001035861 |
MIM | 607469 |
UniProt ID | Q02083 |
Chromosome Location | 4q21.1 |
Function | hydrolase activity; molecular_function; transcription factor binding; |
◆ Recombinant Proteins | ||
Naaa-293M | Active Recombinant Mouse Naaa, His-tagged | +Inquiry |
NAAA-1296H | Recombinant Human NAAA protein, His-tagged | +Inquiry |
NAAA-3881R | Recombinant Rat NAAA Protein | +Inquiry |
NAAA-34H | Recombinant Human NAAA, His-tagged | +Inquiry |
Naaa-5886M | Recombinant Mouse Naaa Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAAA-2127HCL | Recombinant Human NAAA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAAA Products
Required fields are marked with *
My Review for All NAAA Products
Required fields are marked with *
0
Inquiry Basket