Recombinant Human MZT2A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MZT2A-2731H
• Product Overview: FAM128A MS Standard C13 and N15-labeled recombinant protein (NP_001078834) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: MZT2A (Mitotic Spindle Organizing Protein 2A) is a Protein Coding gene. Diseases associated with MZT2A include Keratoconus 9. An important paralog of this gene is MZT2B.
• Molecular Mass: 12.5 kDa
• AA Sequence: MELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MZT2A mitotic spindle organizing protein 2A [ Homo sapiens (human) ]
• Official Symbol: MZT2A
• Synonyms: MZT2A; mitotic spindle organizing protein 2A; FAM128A; MOZART2A; mitotic-spindle organizing protein 2A; family with sequence similarity 128, member A; mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2A
• Gene ID: 653784
• mRNA Refseq: NM_001085365
• Protein Refseq: NP_001078834
• MIM: 613449
• UniProt ID: Q6P582