Recombinant Human MYT1 Protein, GST-tagged

• Cat.No.: MYT1-5868H
• Product Overview: Human MYT1 partial ORF ( NP_004526, 586 a.a. - 685 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: DYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYT1 myelin transcription factor 1 [ Homo sapiens ]
• Official Symbol: MYT1
• Synonyms: MYT1; myelin transcription factor 1; PLPB1; MTF1; MYTI; myelin transcription factor I; proteolipid protein binding protein; proteolipid protein-binding protein; C20orf36
• Gene ID: 4661
• mRNA Refseq: NM_004535
• Protein Refseq: NP_004526
• MIM: 600379
• UniProt ID: Q01538