Recombinant Human Myogenin protein, GST-tagged

• Cat.No.: Myogenin-301187H
• Product Overview: Recombinant Human Myogenin (138-224 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Ser138-Asn224
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: MYOG myogenin [ Homo sapiens (human) ]
• Official Symbol: Myogenin
• Synonyms: MYOG; MYF4; myf-4; bHLHc3
• Gene ID: 4656
• mRNA Refseq: NM_002479
• Protein Refseq: NP_002470
• MIM: 159980
• UniProt ID: P15173