Recombinant Human MAPK1IP1L protein, hFc-tagged

• Cat.No.: MAPK1IP1L-4633H
• Product Overview: Recombinant Human MAPK1IP1L protein(Q8NDC0)(2-245aa), fused with C-terminal hFc tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: C-hFc
• Protein length: 2-245aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53.1 kDa
• AASequence: SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTGMYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAGPLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPHSYH
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: MAPK1IP1L mitogen-activated protein kinase 1 interacting protein 1-like [ Homo sapiens ]
• Official Symbol: MAPK1IP1L
• Synonyms: MAPK1IP1L; mitogen-activated protein kinase 1 interacting protein 1-like; C14orf32, chromosome 14 open reading frame 32 , mitogen activated protein kinase 1 interacting protein 1 like; MAPK-interacting and spindle-stabilizing protein-like; MAPK-interacting and spindle-stabilizing protein; mitogen activated protein kinase 1 interacting protein 1-like; mitogen-activated protein kinase 1-interacting protein 1-like; MISS; C14orf32; c14_5346; MGC23138
• Gene ID: 93487
• mRNA Refseq: NM_144578
• Protein Refseq: NP_653179
• UniProt ID: Q8NDC0