Recombinant Human MYO7B Protein, GST-tagged

• Cat.No.: MYO7B-5845H
• Product Overview: Human MYO7B partial ORF ( XP_291001, 353 a.a. - 449 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is found in brush border microvilli of epithelial cells in the intestines and kidneys. The encoded protein is involved in linking protocadherins to the actin cytoskeleton and is essential for proper microvilli function. This protein aids in the accumulation of intermicrovillar adhesion components such as harmonin and ANKS4B, and this accumulation is necessary for normal brush border action. [provided by RefSeq, Jan 2017]
• Molecular Mass: 36.41 kDa
• AA Sequence: KERSIFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGLLASENWTLGQNDRTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYO7B myosin VIIB [ Homo sapiens ]
• Official Symbol: MYO7B
• Synonyms: MYO7B; myosin VIIB; unconventional myosin-VIIb; myosin-VIIb; DKFZp686A08248
• Gene ID: 4648
• mRNA Refseq: NM_001080527
• Protein Refseq: NP_001073996
• MIM: 606541
• UniProt ID: Q6PIF6