Recombinant Human MYO5A Protein, GST-tagged

• Cat.No.: MYO5A-5841H
• Product Overview: Human MYO5A partial ORF ( NP_000250.1, 1758 a.a. - 1853 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined. [provided by RefSeq
• Molecular Mass: 36.3 kDa
• AA Sequence: KKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYO5A myosin VA (heavy chain 12, myoxin) [ Homo sapiens ]
• Official Symbol: MYO5A
• Synonyms: MYO5A; myosin VA (heavy chain 12, myoxin); MYH12, myosin VA (heavy polypeptide 12, myoxin); unconventional myosin-Va; GS1; MYO5; myosin heavy chain 12; myosin V; myosin; heavy polypeptide kinase; myoxin; MYR12; myosin-12; myosin-Va; myosin, heavy polypeptide kinase; dilute myosin heavy chain, non-muscle; MYH12
• Gene ID: 4644
• mRNA Refseq: NM_000259
• Protein Refseq: NP_000250
• MIM: 160777
• UniProt ID: Q9Y4I1