Recombinant Human MYO1F Protein, GST-tagged

• Cat.No.: MYO1F-5837H
• Product Overview: Human MYO1F partial ORF ( NP_036467.2, 811 a.a. - 912 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Myosins are molecular motors that use the energy from ATP hydrolysis to generate force on actin filaments. The protein encoded by this gene is an unconventional myosin that may be involved in the intracellular movement of membrane-enclosed compartments. There is evidence to suggest that mutations in this gene can result in hearing loss. [provided by RefSeq, Jan 2017]
• Molecular Mass: 36.96 kDa
• AA Sequence: KKKVDIQALRGVSLSTRQDDFFILQEDAADSFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGFGDLAVLKVGGRTLT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYO1F myosin IF [ Homo sapiens (human) ]
• Official Symbol: MYO1F
• Synonyms: MYO1F; myosin IF; unconventional myosin-If; myosin-ID; myosin-Ie
• Gene ID: 4542
• mRNA Refseq: NM_001348355
• Protein Refseq: NP_001335284
• MIM: 601480
• UniProt ID: O00160