Recombinant Human MYNN Protein, GST-tagged

• Cat.No.: MYNN-5828H
• Product Overview: Human MYNN partial ORF ( NP_061127, 501 a.a. - 610 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the BTB/POZ and zinc finger domain-containing protein family that are involved in the control of gene expression. Alternative splicing results in multiple transcript variants and a pseudogene has been identified on chromosome 14. [provided by RefSeq, Jun 2010]
• Molecular Mass: 37.84 kDa
• AA Sequence: CELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYNN myoneurin [ Homo sapiens ]
• Official Symbol: MYNN
• Synonyms: MYNN; myoneurin; SBBIZ1; ZBTB31; ZNF902; zinc finger protein with BTB/POZ domain; zinc finger and BTB domain-containing protein 31; OSZF
• Gene ID: 55892
• mRNA Refseq: NM_001185118
• Protein Refseq: NP_001172047
• MIM: 606042
• UniProt ID: Q9NPC7