Recombinant Human MYL9 protein, His-tagged

• Cat.No.: MYL9-6744H
• Product Overview: Recombinant Human MYL9 protein(P24844)(2-172aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 2-172aa
• Tag: C-His
• Form: Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 ug/mL can bind Anti-MYL9 recombinant antibody, the EC50 is 4.628-6.430 ng/mL.
• Molecular Mass: 21.7kDa
• AASequence: SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: MYL9 myosin, light chain 9, regulatory [ Homo sapiens ]
• Official Symbol: MYL9
• Synonyms: MYL9; myosin, light chain 9, regulatory; myosin, light polypeptide 9, regulatory; myosin regulatory light polypeptide 9; LC20; MLC2; MRLC1; myosin regulatory light chain 1; myosin regulatory light chain 2; smooth muscle isoform; MYRL2; myosin RLC; 20 kDa myosin light chain; myosin regulatory light chain 9; myosin regulatory light chain MRLC1; myosin regulatory light chain 2, smooth muscle isoform; MLC-2C; MGC3505
• Gene ID: 10398
• mRNA Refseq: NM_006097
• Protein Refseq: NP_006088
• MIM: 609905
• UniProt ID: P24844