Recombinant Human MYL6B, His-tagged

• Cat.No.: MYL6B-30243TH
• Product Overview: Recombinant full length Human MLC1SA with an N terminal His tag; 231 amino acids with the tag; predicted MWt: 25.2 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 208 amino acids
• Description: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants.
• Conjugation: HIS
• Molecular Weight: 25.200kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:10% Glycerol, 0.02% DTT, 0.32% Tris-HCl buffer
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
• Sequence Similarities: Contains 3 EF-hand domains.

Gene Information

• Gene Name: MYL6B myosin, light chain 6B, alkali, smooth muscle and non-muscle [ Homo sapiens ]
• Official Symbol: MYL6B
• Synonyms: MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a
• Gene ID: 140465
• mRNA Refseq: NM_001199629
• Protein Refseq: NP_001186558
• MIM: 609930
• Uniprot ID: P14649
• Chromosome Location: 12q13.2
• Pathway: Muscle contraction, organism-specific biosystem; Smooth Muscle Contraction, organism-specific biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem
• Function: calcium ion binding; motor activity; protein binding; structural constituent of muscle