Recombinant Human MYL5 Protein, GST-tagged

• Cat.No.: MYL5-5812H
• Product Overview: Human MYL5 full-length ORF ( AAH40050.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq
• Molecular Mass: 40.26 kDa
• AA Sequence: MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYL5 myosin, light chain 5, regulatory [ Homo sapiens ]
• Official Symbol: MYL5
• Synonyms: MYL5; myosin, light chain 5, regulatory; myosin, light polypeptide 5, regulatory; myosin light chain 5; MYLC2; myLC-2; myosin regulatory light chain 5; superfast myosin regulatory light chain 2
• Gene ID: 4636
• mRNA Refseq: NM_002477
• Protein Refseq: NP_002468
• MIM: 160782
• UniProt ID: Q02045