Recombinant Human MYEOV2 Protein, GST-tagged

• Cat.No.: MYEOV2-5800H
• Product Overview: Human MYEOV2 full-length ORF ( NP_612209.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: COPS9 (COP9 Signalosome Subunit 9) is a Protein Coding gene.
• Molecular Mass: 54.12 kDa
• AA Sequence: MWRAPEAALRPEVSLERRGPEMKPAVDEMFPEGAGPYVDLDEVARARRESPSAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIHSSGLPRTSQQSSMVPALQRGQSEHGVRGKAAERPVVSEERCELNGREVAALDRAFGSTGHGQGAEALMFTRCREHPLCGTNKATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPCIDVR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYEOV2 myeloma overexpressed 2 [ Homo sapiens ]
• Official Symbol: MYEOV2
• Synonyms: MYEOV2; myeloma overexpressed 2
• Gene ID: 150678
• mRNA Refseq: NM_138336
• Protein Refseq: NP_612209
• UniProt ID: Q8WXC6