Recombinant Human MYEOV Protein, GST-tagged

Cat.No. : MYEOV-5799H
Product Overview : Human MYEOV full-length ORF ( AAH11815.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MYEOV (Myeloma Overexpressed) is a Protein Coding gene. Diseases associated with MYEOV include Multiple Myeloma and Deafness, Autosomal Recessive 63.
Molecular Mass : 59.9 kDa
AA Sequence : MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGNRNSGSQSARAVGVAHLGEAFRVGVEQAISSCPEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCVTLAESSCPDYERGRRACLTLHRHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLHHLLLLLLIIILTC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYEOV myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas) [ Homo sapiens ]
Official Symbol MYEOV
Synonyms OCIM; MYEOV; myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas)
Gene ID 26579
mRNA Refseq NM_138768
Protein Refseq NP_620123
MIM 605625
UniProt ID Q96EZ4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYEOV Products

Required fields are marked with *

My Review for All MYEOV Products

Required fields are marked with *

0

Inquiry Basket

cartIcon