Recombinant Human MYEF2 Protein (372-576 aa), His-SUMO-tagged

• Cat.No.: MYEF2-675H
• Product Overview: Recombinant Human MYEF2 Protein (372-576 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transport. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 372-576 aa
• Description: Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 elent 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 37.3 kDa
• AA Sequence: GGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINQGFGDSFGRLGSAMIGGFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: MYEF2 myelin expression factor 2 [ Homo sapiens ]
• Official Symbol: MYEF2
• Synonyms: MEF-2; MST156; MSTP156; HsT18564
• Gene ID: 50804
• mRNA Refseq: NM_016132.3
• Protein Refseq: NP_057216.2
• UniProt ID: Q9P2K5