Recombinant Full Length Human MYEF2 Protein, GST-tagged

• Cat.No.: MYEF2-6732HF
• Product Overview: Human MYEF2 full-length ORF ( AAH14533, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 211 amino acids
• Description: MYEF2 (Myelin Expression Factor 2) is a Protein Coding gene. Diseases associated with MYEF2 include Loeys-Dietz Syndrome. Among its related pathways are Physiological and Pathological Hypertrophy of the Heart and MicroRNAs in cardiomyocyte hypertrophy. GO annotations related to this gene include nucleic acid binding and nucleotide binding. An important paralog of this gene is HNRNPM.
• Molecular Mass: 48.95 kDa
• AA Sequence: MDGPGFGGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINRGFGDSFGRLGGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYEF2 myelin expression factor 2 [ Homo sapiens ]
• Official Symbol: MYEF2
• Synonyms: MEF-2; MST156; MSTP156; HsT18564
• Gene ID: 50804
• mRNA Refseq: NM_016132
• Protein Refseq: NP_057216
• MIM: 619395
• UniProt ID: Q9P2K5