Recombinant Human MYD88 protein, GST-tagged

• Cat.No.: MYD88-301137H
• Product Overview: Recombinant Human MYD88 (1-150 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Leu150
• AA Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ]
• Official Symbol: MYD88
• Synonyms: MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88; MYD88D
• Gene ID: 4615
• mRNA Refseq: NM_001172566
• Protein Refseq: NP_001166037
• MIM: 602170
• UniProt ID: Q99836